top of page

CircRNA

Gene

chr9|128122666|128122843|1|177|0

PTGES2

Open Reading Frame (ORF)

LAPPLWLSPWPAGGRGLGQVGNALWIMGPLAKMGLGPRAPAHLPWGQQGWP

Peptide

LAPPLWLSPWPAGGRGLGQVGNALWIMGPLAK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

32

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

34 63 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page