top of page

CircRNA

Gene

chr9|125213369|125220700|2|143,143|0,7188

RABEPK

Open Reading Frame (ORF)

LETSYMSLGAEREVPSPCRTRSCMCLTQENTSGT

Peptide

LETSYMSLGAER

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

12

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 37 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page