top of page

CircRNA

Gene

chr9|124860621|124860816|1|195|0

ENST00000373570

Open Reading Frame (ORF)

LFASVSWLVVTPLCKCLVSLSLVEAGVGGLDKHSCTLNPQKPC

Peptide

CLVSLSLVEAGVGGLDK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

17

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

17 35 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page