top of page

CircRNA

Gene

chr9|112250928|112252788|3|74,36,111|0,139,1749

PTBP3

Open Reading Frame (ORF)

LKIITFTKNNQFQALLQYADPVNAHYAKMALDGQNIYNACCRLHSLRPSYW

Peptide

MALDGQNIYNACCR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

14

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

7

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

3 7 5 4 6 3 6

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

TRUE

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page