top of page

CircRNA

Gene

chr8|99501710|99502868|2|148,33|0,1125

VPS13B

Open Reading Frame (ORF)

LEQTTSNIGGTSGRVSLWMQWVLPKITIKLFAPDPENKGTEVCMVSELEDLRITILRFCDLGTNYK

Peptide

LFAPDPENKGTEVCMVSELEDLR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

23

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

3

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

34 33 3 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page