top of page

CircRNA

Gene

chr7|75538146|75542882|4|78,109,62,32|0,1176,3772,4704

HIP1

Open Reading Frame (ORF)

LGRRNRGISTYTARSGNRKRIEPNQHPICHISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAGVAEGWEEGTEASPPTLQEVVTEKE

Peptide

GISTYTAR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

8

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 0 25 0 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page