top of page

CircRNA

Gene

chr7|5712780|5715099|2|83,47|0,2272

RNF216

Open Reading Frame (ORF)

LELSCMEGSCTCSFPTSELEKVLPQTILVSHQICPRGSLWIWKVGAQLHGRQLHVFVPNQ

Peptide

VGAQLHGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

8

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

2 23 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page