top of page

CircRNA

Gene

chr7|44385647|44385801|1|154|0

NUDCD3

Open Reading Frame (ORF)

LQWLVAVETKACDPNLLGYPLLHFKHLHSVSATQNSVKTTASREQGRKDMLPAVAGCCGDKSM

Peptide

HLHSVSATQNSVKTTASR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

18

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

24 31 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page