top of page

CircRNA

Gene

chr7|117136080|117189393|4|155,98,115,73|0,2354,34781,53240

ST7

Open Reading Frame (ORF)

LEMAVTDALSSYNIMDPSMKPNIDETPMSWCTSKEG

Peptide

LEMAVTDALSSYNIMDPSMKPNIDETPMSWCTSK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

34

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

69 34 0 0 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page