top of page

CircRNA

Gene

chr7|100023418|100024307|3|21,168,154|0,346,735

ZKSCAN1

Open Reading Frame (ORF)

LIYQDNRSQVKFMDLRCSQGGWCLWIQFRSPRALTFITRPPSPTSNIRLGNPASYSHEE

Peptide

LIYQDNR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

7

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 20 2 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page