top of page

CircRNA

Gene

chr6|43138848|43139223|2|134,88|0,287

PTK7

Open Reading Frame (ORF)

MVPLYEHCALLAEEAPRQPAGGGQTRLLGLPDPGHTKTYSCLVQKPDAHLRGLTVRGLQEWDLAHQQRGGV

Peptide

MVPLYEHCALLAEEAPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

17

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 20 32 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page