top of page

CircRNA

Gene

chr6|1958209|1958565|1|356|0

ENST00000531690

Open Reading Frame (ORF)

LQVEKLREEEHRNPNNVYEHVCEKEAGITTTEQTLWAPSYHMLQATTARIFLFLSPLPLAPRTTKFIKEMFLTACEFVFLSGNVMTG

Peptide

EAGITTTEQTLWAPSYHMLQATTAR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

25

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

76 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page