top of page

CircRNA

Gene

chr5|95858519|95858647|1|128|0

ENST00000620167.1

Open Reading Frame (ORF)

LSTEQFLTNPTRSMTTMPLFLPLRGHAQTPHMNTPHYTPPQNLCQLNNSLPIQQGV

Peptide

LSTEQFLTNPTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

12

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

37 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page