top of page

CircRNA

Gene

chr5|179800053|179800259|2|15,76|0,130

MGAT4B

Open Reading Frame (ORF)

MMYAQSKGIYYVQLEDDIVEDQTEPRLLLPHDVRAVQRHLLRAAGG

Peptide

AVQRHLLR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

8

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

25 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page