top of page

CircRNA

Gene

chr5|178212972|178213103|1|131|0

PHYKPL

Open Reading Frame (ORF)

LKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTG

Peptide

LDAILTG

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

7

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

19 2 0

isoCirc,CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page