top of page

CircRNA

Gene

chr5|10411330|10411450|1|120|0

MARCHF6

Open Reading Frame (ORF)

MKIPAFSHHRNSVVISSMLIIVNLLICTVFIFFLVSQ

Peptide

IPAFSHHR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

8

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

6 19 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page