top of page

CircRNA

Gene

chr4|76740054|76740161|1|107|0

SHROOM3

Open Reading Frame (ORF)

LEREGLGQSLSGNFGKTKSAFSAISRKTTMPTSGGGWREKA

Peptide

TKSAFSAISR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

10

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

17 14 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page