top of page

CircRNA

Gene

chr4|4424652|4424810|1|158|0

ENST00000515687.5

Open Reading Frame (ORF)

LLLYPPGSQECRRQGLGHSHMHPLASSFCGKAWSMLKLTKGSPLLQMVPLGSACSCTHQGVRNAEGKALVTHTCTR

Peptide

GSPLLQMVPLGSACSCTHQGVRNAEGK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

27

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

82 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page