top of page

CircRNA

Gene

chr4|148073341|148073546|1|205|0

ENST00000510076.1

Open Reading Frame (ORF)

LPWNVGLSFSGLRILKPAPCPRGCSGAGMTFHASPWEVPGPVRLLSNIYQRTDVSTSHRCNNLLGKRGLALECGA

Peptide

ILKPAPCPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

9

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

28 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page