top of page

CircRNA

Gene

chr3|9806861|9807062|1|201|0

ARPC4

Open Reading Frame (ORF)

LGGHPMAPVARGEGGSTRIRKGTASVGAEEPEQAGGGPGQEALEDSPRHLWHRHWH

Peptide

GEGGSTRIR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

9

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

3

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

3 4 18

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page