top of page

CircRNA

Gene

chr3|9453738|9464672|2|130,36|0,10898

SETD5

Open Reading Frame (ORF)

LYPKRLELSTYTKAMRIVALLVSAKTMQTASRCNTPLQFERWIKQALEEGMTQTSSVPQETRTQHLYQSNENSSSSSICKDNADC

Peptide

TMQTASR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

7

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

9 13 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page