top of page

CircRNA

Gene

chr3|47661293|47678311|2|121,33|0,16985

SMARCC1

Open Reading Frame (ORF)

LAYRNFMIDTLKLMSRKYKKQHEPLGKWIPPTVWRAAALQAQGPMSQRSLILGISKFYD

Peptide

WIPPTVWR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

8

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 25 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page