top of page

CircRNA

Gene

chr3|184321486|184321632|1|146|0

EIF4G1

Open Reading Frame (ORF)

LEENSDSGTGLLSVTSTSSMGSARGVGSGERRYGSPVSREMGGWEPGEDWKKTQILEPVC

Peptide

LEENSDSGTGLLSVTSTSSMGSARGVGSGER

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

31

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

94 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page