top of page

CircRNA

Gene

chr3|172247532|172251541|2|110,229|0,3780

FNDC3B

Open Reading Frame (ORF)

LKIVLESAGWWSHPSLLSVIPQATPQPCLQPIISLQQASAQKTERPPDRSPEPPQQPSFFYLQKQLHNSIQWLWEGP

Peptide

TERPPDRSPEPPQQPSFFYLQK

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

22

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 67 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page