top of page

CircRNA

Gene

chr3|149846010|149921227|3|33,106,94|0,65967,75123

RNF13

Open Reading Frame (ORF)

LSRIDIELEETDFVKINLRNFLYINSRKVILQRDAALHRGPPYLSSRI

Peptide

INLRNFLYINSR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

12

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

4

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 0 2 2 19 6

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page