top of page

CircRNA

Gene

chr22|41905856|41906093|1|237|0

SHISA8

Open Reading Frame (ORF)

LAAWELPLLLSSQGCPVSALPPILSRPPGEGMLGTGLRATAPWCSETAVPQRKPDKN

Peptide

ATAPWCSETAVPQR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

14

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

43 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page