top of page

CircRNA

Gene

chr22|37568774|37568938|1|164|0

CDC42EP1

Open Reading Frame (ORF)

LVPTRPERGEVMLPLNPSPPLNLRMLRRMMRSRCEGLGHGPRAPPRCRAGPSPNSWFLPDRRGEKSCCP

Peptide

SRCEGLGHGPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

11

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

34 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page