top of page

CircRNA

Gene

chr21|37420298|37472880|3|86,106,31|0,52385,52551

DYRK1A

Open Reading Frame (ORF)

MRLERRRCIQEERLQHANLHLFGLHRHFHSMLLAFRWLDRCPIHIMTRFSNL

Peptide

HFHSMLLAFR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

10

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 31 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page