top of page

CircRNA

Gene

chr20|44930731|44930973|1|242|0

PABPC1L

Open Reading Frame (ORF)

LTNTISPFYREGNKDFLMSPRQKQVRNLHFPRTLVFMLCLAGAGGKAAVGVAGRPISQTCWIIKSLFQHNIHELLSLGNAI

Peptide

NLHFPRTLVFMLCLAGAGGK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

20

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

61 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page