top of page

CircRNA

Gene

chr20|31664767|31665000|1|233|0

BCL2L1

Open Reading Frame (ORF)

LPGQADLCPMPVQPGQPGCQGQSGLARSSSGLPLSSAPPLACLIPRGPSHPGLSAQAGRAGRRACCMGWGRAD

Peptide

GPSHPGLSAQAGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

13

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

25 15 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page