top of page

CircRNA

Gene

chr2|85318724|85339524|2|102,143|0,20657

SLC30A7

Open Reading Frame (ORF)

MAFSDTCADRILNWKPSWEYYVRAYVTSCQVFPRCLSLSTQTGLQLPFWTQGKSKTSLCRKAEATGKDLTASYIYSDIVPP

Peptide

AYVTSCQVFPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

11

3

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

34 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page