top of page

CircRNA

Gene

chr2|27381568|27382155|2|237,30|0,557

PPM1G

Open Reading Frame (ORF)

LRGLKKMATATRRRRPSETSSHPDPCPPRLFGYCHPLWKSCWISAWHQTLLGMVQGVTT

Peptide

RPSETSSHPDPCPPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

15

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 46 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page