top of page

CircRNA

Gene

chr2|26776371|26778055|2|111,14|0,1670

SLC35F6

Open Reading Frame (ORF)

MCTHCGQLALRASLALGPVDHHGPDHRCHPDGARGEVRLQTQCAPTAGSWH

Peptide

ASLALGPVDHHGPDHR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

16

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

5

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

3 11 20 1 9

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page