top of page

CircRNA

Gene

chr2|24821319|24821571|1|252|0

ADCY3

Open Reading Frame (ORF)

LPRSRLPSHAGAWPTTRRDMRLRTTEAIRVGRFTHSQGKET

Peptide

LPSHAGAWPTTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

12

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

37 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page