top of page

CircRNA

Gene

chr2|113627381|113628669|2|19,120|0,1168

RABL2A

Open Reading Frame (ORF)

MAEDKTKPSELDQGKYDADDNPSLGTAHSDNTLPSLGLDPSLQLGANGRRQNQTE

Peptide

YDADDNPSLGTAHSDNTLPSLGLDPSLQLGANGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

34

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

3

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 18 19 66 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page