top of page

CircRNA

Gene

chr19|6697343|6697794|2|213,143|0,308

C3

Open Reading Frame (ORF)

LCGRPLRGHSNAGLLHRPAATLLCCSKRAGGNPSRSLQLPAEPRAQGEGGTTPQSSLLQPGHHQEASPADRNHPPQVLVVRSICHRAAKDRPAGSGSQGCCLPSFHQ

Peptide

AGGNPSR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

7

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

22 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page