top of page

CircRNA

Gene

chr19|47003722|47003880|1|158|0

ARHGAP35

Open Reading Frame (ORF)

MCLSLSRWTEGDIIGAARWPEGDGGIPVPHSAPAALRERRPGSSQHPLDSSAGCVCLCHGGQRVTS

Peptide

MCLSLSRWTEGDIIGAAR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

18

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

55 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page