top of page

CircRNA

Gene

chr19|45842249|45844200|2|31,60|0,1891

SYMPK

Open Reading Frame (ORF)

LEQLLKFMVHLGLHTQEDEAGRAMGRGQGSLGAAA

Peptide

AMGRGQGSLGAAA

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

13

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

39 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

true

false

bottom of page