top of page

CircRNA

Gene

chr19|44756301|44757192|2|39,176|0,715

BCL3

Open Reading Frame (ORF)

LAVITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTGAGSSTSTTTYGRHRSTWL

Peptide

ALLDSAAPGTGAGSSTSTTTYGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

23

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

3

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 29 39 2 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page