top of page

CircRNA

Gene

chr19|41423075|41423169|1|94|0

ENSG00000255730

Open Reading Frame (ORF)

LRHYLLSQGWWDEEQEKAWRKQSRRKPPHLPAAALSAEPRLVG

Peptide

RKPPHLPAAALSAEPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

16

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

7 42 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page