top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr19|3979328|3980066|2|108,259|0,479

EEF2

Open Reading Frame (ORF)

LMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPIKNNLDDGPLRGAHRGCALWEHCGPRGRGPVPGEDGHHHHLRARAQHAGDEVQRQPCCQSGRGGQEPG

Peptide

GCALWEHCGPRGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

13

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

40 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page