top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr19|3978104|3979424|2|68,96|0,1224

EEF2

Open Reading Frame (ORF)

LTRSSRTARRSVKSRTCSASPRVGRAYHRGRRRAAPGDLPEGPGGGPRLHPHQEI

Peptide

RAAPGDLPEGPGGGPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

16

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA,PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

49 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page