top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr19|35250634|35266405|3|25,120,47|0,8310,15724

LSR

Open Reading Frame (ORF)

LTRRRGGTVVCITAPWSQPRTSRGTMRPTQSSSSLCMPPAKQPPQVFPAFMAGGLPSPEMLT

Peptide

QPPQVFPAFMAGGLPSPEMLT

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

21

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

3

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 29 25 9 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page