top of page

CircRNA

Gene

chr19|35013576|35014280|2|115,92|0,612

GRAMD1A

Open Reading Frame (ORF)

LTAARSQAQWVRAVAMSRPTFPEPAATQTMGQRRTRRSR

Peptide

AVAMSRPTFPEPAATQTMGQRR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

22

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

56 11 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page