top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr19|34330188|34339992|3|27,82,126|0,3531,9678

GARRE1

Open Reading Frame (ORF)

LKEDPATMSLLQRSLDPEKTLGLVDVLYTAVLDLNRWRAGSIQCYS

Peptide

WRAGSIQCYS

ORF Found in Short-Read

Peptide Type

ORF Type

true

Junction

Junction

Peptide Length

Frame

Start Codon

10

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 14 16 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page