top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr19|2353874|2354069|1|195|0

SPPL2B

Open Reading Frame (ORF)

MVATSRSPAGATWWGGRLSDCPSDKQGWAPGRLGQALRGPWSPGREGLGRGRCLAMPAHSSPF

Peptide

GPWSPGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

7

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

22 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page