top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr19|17101659|17102557|2|71,23|0,875

MYO9B

Open Reading Frame (ORF)

LGGMLKPGGRQDECESGCWPCAGAPGHARPEPGRHAEARRPAG

Peptide

LGGMLKPGGR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

10

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

31 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Exist in Short-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

true

false

bottom of page