top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr19|15265545|15267513|2|263,98|0,1870

BRD4

Open Reading Frame (ORF)

LQKINELPTEETEIMIVQAKGRGRGRKETGTGGRVWQSGVWDVRLSGKCNTRMCVHCVWCMSPRGQPACGCQHGL

Peptide

ETGTGGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

7

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

7 15 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page