top of page

CircRNA

Gene

chr19|1277172|1277308|1|136|0

FAM174C

Open Reading Frame (ORF)

LRLLQPGSRVHTISDSGTQTPSPRRCPARPSPWGPQCWRGGRIASAEASSTWK

Peptide

VHTISDSGTQTPSPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

15

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

46 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page