top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr19|11147104|11148050|3|185,77,38|0,713,908

SPC24

Open Reading Frame (ORF)

LESGGHRVVARSLVAASCTQRASAVVRSISNEMWGRRRGHDSHNPLGRVRGSTLPPS

Peptide

RGHDSHNPLGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

11

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

33 1 0 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page